HORDB

ID: hor006417
Uniprot ID: P27596
Protein name: Atrial natriuretic factor
Gene name: NPPA
Organism: Cavia porcellus (Guinea pig)
Family: Natriuretic peptide family
Source: Animal
Expression: Adult.
Disease: NA
Comments: NA
Taxonomy: Cavia (genus), Caviidae (family), Hystricomorpha (suborder), Rodentia (order), Glires , Euarchontoglires (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
GO MF: GO:0005179 hormone activity
GO BP: GO:0003008 system process; GO:0006182 cGMP biosynthetic process; GO:0007168 receptor guanylyl cyclase signaling pathway; GO:0007565 female pregnancy; GO:0008217 regulation of blood pressure; GO:0097746 blood vessel diameter maintenance
GO CC: GO:0005576 extracellular region; GO:0042995 cell projection; GO:0043204 perikaryon

Sequence: SLRRSSCFGGRMDRIGAQSSLGCNSFRY
Length: 28(99-126)
Propeptide: NPMYNVVSNADLVDFKNLLDHLEEKMPLEDEVVLPQVASEQNEEAGAVLSALPEVPSWPGEAGPAQREGGALGRGPWDSSDRSAPLKSKLRALLDAPRSLRRSSCFGGRMDRIGAQSSLGCNSFRYRR
Signal peptide: NA
Modification: T6 Phosphoserine
Glycosylation: NA
Mutagenesis: NA

Function: [Atrial natriuretic peptide]: Hormone that plays a key role in mediating cardio-renal homeostasis, and is involved in vascular remodeling and regulating energy metabolism. Acts by specifically binding and stimulating NPR1 to produce cGMP, which in turn ac
Mechanism: NA
Cross BBB: NA
Target: NPR1, NPR2
Target Unid: H0W391, H0UTW0
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor006417_AF2.pdb

hor006417_ESM.pdb

Mass:	359426	Formula:	C128H207N45O40S3
Absent amino acids:	EHKPTVW	Common amino acids:	S
pI:	10.95	Basic residues:	5
Polar residues:	14	Hydrophobic residues:	6
Hydrophobicity:	-51.07	Boman Index:	-8484
Half-Life:	1.9 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	45.36
Instability Index:	8943.21	Extinction Coefficient cystines:	1615
Absorbance 280nm:	59.81